Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily) beta(3)-alpha(3); meander and up-and-down bundle |
Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) |
Family d.54.1.0: automated matches [227195] (1 protein) not a true family |
Protein automated matches [226922] (95 species) not a true protein |
Species Mycobacterium tuberculosis [TaxId:1773] [420110] (2 PDB entries) |
Domain d7dlra1: 7dlr A:1-139 [421245] Other proteins in same PDB: d7dlra2 automated match to d7ckpa1 complexed with act, cl, edo, mg, peg, pep; mutant |
PDB Entry: 7dlr (more details), 2.25 Å
SCOPe Domain Sequences for d7dlra1:
Sequence; same for both SEQRES and ATOM records: (download)
>d7dlra1 d.54.1.0 (A:1-139) automated matches {Mycobacterium tuberculosis [TaxId: 1773]} mpiieqvrareildsrgnptvevevalidgtfaraavpsgastgeheavelrdggdrygg kgvqkavqavldeigpaviglnaddqrlvdqalvdldgtpdksrlggnailgvslavaka aadsaelplfryvggpnah
Timeline for d7dlra1: