SCOPe 2.08: Domain d7cvuc1: 7cvu C:4-221

Lineage for d7cvuc1 (7cvu C:4-221)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest

4. Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families)

5. Family c.66.1.0: automated matches [191451] (1 protein)
   not a true family

6. Protein automated matches [190689] (87 species)
   not a true protein

7. Species Niastella koreensis [TaxId:700598] [394489] (4 PDB entries)

8. Domain d7cvuc1: 7cvu C:4-221 [421236]
   Other proteins in same PDB: d7cvua2, d7cvub2, d7cvuc2, d7cvud2
   automated match to d7cvxa_
   complexed with gol

Details for d7cvuc1

PDB Entry: 7cvu, 1.75 Å

PDB Description: crystal structure of catechol o-methyl transferase (comt) from niastella koreensis

PDB Compounds: (C:) O-methyltransferase family 3

SCOPe Domain Sequences for d7cvuc1:

Sequence; same for both SEQRES and ATOM records:

>d7cvuc1 c.66.1.0 (C:4-221) automated matches {Niastella koreensis [TaxId: 700598]}
qifesvdhyisdllgyeddallaatnslaeagmpaisvspnqgkflqllaqlcqaknile
lgtlagystiwmaralpkngrlitleydpkhaavaqknidragltsqvqirtgkaidilp
qlveegagpfdmifidadkppyteyfqwalrlsrpgtlivadnvirdgkvldenstepav
qgarrfnamlgantavdatilqmvgvkeydgmalaivk

Timeline for d7cvuc1:

• d7cvuc1 is new in SCOPe 2.08-stable