SCOPe 2.08: Domain d7dbgb_: 7dbg B:

Lineage for d7dbgb_ (7dbg B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.55: PH domain-like barrel [50728] (3 superfamilies)
   barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix

4. Superfamily b.55.1: PH domain-like [50729] (14 families)

5. Family b.55.1.0: automated matches [191311] (1 protein)
   not a true family

6. Protein automated matches [190052] (8 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [194506] (63 PDB entries)

8. Domain d7dbgb_: 7dbg B: [421204]
   Other proteins in same PDB: d7dbga_
   automated match to d6citb_
   complexed with cl, dms, gol, gtp, mg, mpo

Details for d7dbgb_

PDB Entry: 7dbg, 2.06 Å

PDB Description: yeast crm1e (apo) in complex with ran-ranbp1

PDB Compounds: (B:) YRB1 isoform 1

SCOPe Domain Sequences for d7dbgb_:

Sequence; same for both SEQRES and ATOM records:

>d7dbgb_ b.55.1.0 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
deevlykvraklfrfdadakewkergtgdckflknkktnkvrilmrrdktlkicanhiia
peytlkpnvgsdrswvyactadiaegeaeaftfairfgskenadkfkeefekaqeinkk

Timeline for d7dbgb_:

• d7dbgb_ is new in SCOPe 2.08-stable