Lineage for d7digg_ (7dig G:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2939772Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 2939773Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 2940626Family d.22.1.0: automated matches [191400] (1 protein)
    not a true family
  6. 2940627Protein automated matches [190526] (26 species)
    not a true protein
  7. 3084828Species Dendronephthya sp. [TaxId:191210] [421145] (1 PDB entry)
  8. 3084882Domain d7digg_: 7dig G: [421199]
    automated match to d5exbf_

Details for d7digg_

PDB Entry: 7dig (more details), 2.6 Å

PDB Description: green fluorescent protein from dendronephthya sp. ssal-2002
PDB Compounds: (G:) Green fluorescent protein

SCOPe Domain Sequences for d7digg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7digg_ d.22.1.0 (G:) automated matches {Dendronephthya sp. [TaxId: 191210]}
likedmrvkvhmegnvnghafviegegkgkpyegtqtlnltvkegaplpfsydilttalh
ygnrvftkypedipdyfkqsfpegyswertmtyedkgictirsdislegdcffqnvrfng
mnfppngpvmqkktlkwepsteklhvrdgllvgninmallleggghylcdfkttykakkv
vqlpdyhfvdhrieilsndsdynkvklyehgvarysplpsq

SCOPe Domain Coordinates for d7digg_:

Click to download the PDB-style file with coordinates for d7digg_.
(The format of our PDB-style files is described here.)

Timeline for d7digg_:

  • d7digg_ is new in SCOPe 2.08-stable