Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.22: GFP-like [54510] (1 superfamily) beta-sheet folds into a barrel (n=11, S=14) around the central helix |
Superfamily d.22.1: GFP-like [54511] (3 families) |
Family d.22.1.0: automated matches [191400] (1 protein) not a true family |
Protein automated matches [190526] (26 species) not a true protein |
Species Dendronephthya sp. [TaxId:191210] [421145] (1 PDB entry) |
Domain d7digg_: 7dig G: [421199] automated match to d5exbf_ |
PDB Entry: 7dig (more details), 2.6 Å
SCOPe Domain Sequences for d7digg_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7digg_ d.22.1.0 (G:) automated matches {Dendronephthya sp. [TaxId: 191210]} likedmrvkvhmegnvnghafviegegkgkpyegtqtlnltvkegaplpfsydilttalh ygnrvftkypedipdyfkqsfpegyswertmtyedkgictirsdislegdcffqnvrfng mnfppngpvmqkktlkwepsteklhvrdgllvgninmallleggghylcdfkttykakkv vqlpdyhfvdhrieilsndsdynkvklyehgvarysplpsq
Timeline for d7digg_: