SCOPe 2.08: Domain d7dlba_: 7dlb A:

Lineage for d7dlba_ (7dlb A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (10 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.1: Ferritin [47241] (10 proteins)

6. Protein automated matches [190041] (34 species)
   not a true protein

7. Species Crassostrea gigas [TaxId:29159] [397195] (2 PDB entries)

8. Domain d7dlba_: 7dlb A: [421193]
   automated match to d6ljga_
   complexed with fe; mutant

Details for d7dlba_

PDB Entry: 7dlb, 2.5 Å

PDB Description: crassostrea gigas ferritin mutant-d119k

PDB Compounds: (A:) Ferritin

SCOPe Domain Sequences for d7dlba_:

Sequence; same for both SEQRES and ATOM records:

>d7dlba_ a.25.1.1 (A:) automated matches {Crassostrea gigas [TaxId: 29159]}
esqcrqnyhqeseaginrqinmelyacytyqsmayyfdrddvalpgfskffknssdeere
haeklmkyqnkrggrvvlqdikkpdrdewgtgldamqvalqlektvnqslldlhkvaksh
qdaqmcdflethyleeqvnaikeisdhitqlkrvgsglgeyeydrrlds

Timeline for d7dlba_:

• d7dlba_ is new in SCOPe 2.08-stable