Lineage for d1hyhc2 (1hyh C:167-329)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 420654Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 420655Superfamily d.162.1: LDH C-terminal domain-like [56327] (2 families) (S)
  5. 420656Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (4 proteins)
    N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)
  6. 420657Protein L-2-hydroxyisocapronate dehydrogenase, L-HICDH [56337] (1 species)
  7. 420658Species Lactobacillus confusus [TaxId:1583] [56338] (1 PDB entry)
  8. 420661Domain d1hyhc2: 1hyh C:167-329 [42119]
    Other proteins in same PDB: d1hyha1, d1hyhb1, d1hyhc1, d1hyhd1

Details for d1hyhc2

PDB Entry: 1hyh (more details), 2.2 Å

PDB Description: crystal structure of l-2-hydroxyisocaproate dehydrogenase from lactobacillus confusus at 2.2 angstroms resolution-an example of strong asymmetry between subunits

SCOP Domain Sequences for d1hyhc2:

Sequence, based on SEQRES records: (download)

>d1hyhc2 d.162.1.1 (C:167-329) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus}
gtlldtarmqravgeafdldprsvsgynlgehgnsqfvawstvrvmgqpivtladagdid
laaieeearkggftvlngkgytsygvatsairiakavmadahaelvvsnrrddmgmylsy
paiigrdgvlaettldlttdeqekllqsrdyiqqrfdeivdtl

Sequence, based on observed residues (ATOM records): (download)

>d1hyhc2 d.162.1.1 (C:167-329) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus}
gtlldtarmqravgeafdldprsvsgynlgehgnsqfvawstvrvmgqpivtladaidla
aieeearkggftvlngkgytsygvatsairiakavmadahaelvvsnrrddmgmylsypa
iigrdgvlaettldlttdeqekllqsrdyiqqrfdeivdtl

SCOP Domain Coordinates for d1hyhc2:

Click to download the PDB-style file with coordinates for d1hyhc2.
(The format of our PDB-style files is described here.)

Timeline for d1hyhc2: