Lineage for d7dkpd1 (7dkp D:1-75)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2876589Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins)
  6. 2877231Protein Glutaredoxin 2 [64060] (1 species)
    similar to class zeta enzymes
  7. 2877232Species Escherichia coli [TaxId:562] [64061] (4 PDB entries)
  8. 3084858Domain d7dkpd1: 7dkp D:1-75 [421175]
    Other proteins in same PDB: d7dkpa2, d7dkpb2, d7dkpc2, d7dkpd2
    automated match to d1g7oa2
    complexed with flc, gsh

Details for d7dkpd1

PDB Entry: 7dkp (more details), 1.45 Å

PDB Description: crystal structure of e. coli grx2 in complex with gsh at 1.45 a resolution
PDB Compounds: (D:) glutaredoxin

SCOPe Domain Sequences for d7dkpd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d7dkpd1 c.47.1.5 (D:1-75) Glutaredoxin 2 {Escherichia coli [TaxId: 562]}
mklyiydhcpyclkarmifglknipvelhvllnddaetptrmvgqkqvpilqkddsrymp
esmdivhyvdkldgk

SCOPe Domain Coordinates for d7dkpd1:

Click to download the PDB-style file with coordinates for d7dkpd1.
(The format of our PDB-style files is described here.)

Timeline for d7dkpd1:

  • d7dkpd1 is new in SCOPe 2.08-stable