Lineage for d1hlpb2 (1hlp B:163-328)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 513617Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 513618Superfamily d.162.1: LDH C-terminal domain-like [56327] (2 families) (S)
  5. 513619Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (4 proteins)
    N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)
  6. 513710Protein Malate dehydrogenase [56329] (11 species)
  7. 513715Species Archaeon Haloarcula marismortui [TaxId:2238] [56335] (5 PDB entries)
  8. 513725Domain d1hlpb2: 1hlp B:163-328 [42113]
    Other proteins in same PDB: d1hlpa1, d1hlpb1

Details for d1hlpb2

PDB Entry: 1hlp (more details), 3.2 Å

PDB Description: structural features stabilizing halophilic malate dehydrogenase from an archaebacterium

SCOP Domain Sequences for d1hlpb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hlpb2 d.162.1.1 (B:163-328) Malate dehydrogenase {Archaeon Haloarcula marismortui}
grldsarfryvlseefdapvqnvegtilgehgdaqvpvfskvrvdgtdpefsgdekeqll
gdlqesamdvierkgatewgpargvahmveailhdtgevlpasvklegefghedtafgvp
vrlgsngveeivewdlddyeqdlmadaaeklsdqydkis

SCOP Domain Coordinates for d1hlpb2:

Click to download the PDB-style file with coordinates for d1hlpb2.
(The format of our PDB-style files is described here.)

Timeline for d1hlpb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1hlpb1