Lineage for d7dbja2 (7dbj A:162-334)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2998746Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 2998747Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) (S)
  5. 2998748Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins)
    N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)
    automatically mapped to Pfam PF02866
  6. 2998755Protein Lactate dehydrogenase [56339] (20 species)
  7. 2998819Species Human (Homo sapiens), heart isoform (H chain) [TaxId:9606] [64444] (4 PDB entries)
  8. 3084809Domain d7dbja2: 7dbj A:162-334 [421126]
    Other proteins in same PDB: d7dbja1, d7dbjb1, d7dbjc1, d7dbjd1
    automated match to d1i0za2
    complexed with edo, h1u, nai, oxm

Details for d7dbja2

PDB Entry: 7dbj (more details), 1.55 Å

PDB Description: crystal structure of human ldhb in complex with nadh, oxamate, and axko-0046
PDB Compounds: (A:) L-lactate dehydrogenase B chain

SCOPe Domain Sequences for d7dbja2:

Sequence; same for both SEQRES and ATOM records: (download)

>d7dbja2 d.162.1.1 (A:162-334) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain) [TaxId: 9606]}
sgcnldsarfrylmaeklgihpsschgwilgehgdssvavwsgvnvagvslqelnpemgt
dndsenwkevhkmvvesayeviklkgytnwaiglsvadliesmlknlsrihpvstmvkgm
ygienevflslpcilnargltsvinqklkddevaqlkksadtlwdiqkdlkdl

SCOPe Domain Coordinates for d7dbja2:

Click to download the PDB-style file with coordinates for d7dbja2.
(The format of our PDB-style files is described here.)

Timeline for d7dbja2:

  • d7dbja2 is new in SCOPe 2.08-stable