SCOPe 2.08: Domain d7daal2: 7daa L:111-217

Lineage for d7daal2 (7daa L:111-217)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)

8. Domain d7daal2: 7daa L:111-217 [421123]
   Other proteins in same PDB: d7daah_, d7daal1
   automated match to d5bk2d2
   complexed with cd

Details for d7daal2

PDB Entry: 7daa, 2.51 Å

PDB Description: crystal structure of basigin complexed with anti-basigin fab fragment

PDB Compounds: (L:) Light chain of antibody Fab fragment

SCOPe Domain Sequences for d7daal2:

Sequence; same for both SEQRES and ATOM records:

>d7daal2 b.1.1.2 (L:111-217) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdctyslsstltlskadyekhkvyacevthqglsspvtksfnrge

Timeline for d7daal2:

• d7daal2 is new in SCOPe 2.08-stable