SCOPe 2.08: Domain d7cvte1: 7cvt E:2-121

Lineage for d7cvte1 (7cvt E:2-121)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 2.2 [TaxId:10090] [88550] (62 PDB entries)
   Uniprot P01811 # HV41_MOUSE (P01811) Ig heavy chain V region UPC10

8. Domain d7cvte1: 7cvt E:2-121 [421120]
   Other proteins in same PDB: d7cvtc2, d7cvtd1, d7cvtd2, d7cvte2, d7cvtf1, d7cvtf2
   automated match to d1otsc1
   complexed with cl; mutant

Details for d7cvte1

PDB Entry: 7cvt, 2.9 Å

PDB Description: crystal structure of the c85a/l194a/h234c mutant clc-ec1 with fab fragment

PDB Compounds: (E:) antibody fab fragment heavy chain

SCOPe Domain Sequences for d7cvte1:

Sequence; same for both SEQRES and ATOM records:

>d7cvte1 b.1.1.1 (E:2-121) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 2.2 [TaxId: 10090]}
vrllesggglvqpggslklscaasgfdysrywmswvrqapgkglkwigeinpvsstinyt
pslkdkfiisrdnakdtlylqiskvrsedtalyycarlyygygywyfdvwgagttvtvss

Timeline for d7cvte1:

• d7cvte1 is new in SCOPe 2.08-stable