Lineage for d1hlpa2 (1hlp A:163-328)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2232528Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 2232529Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) (S)
  5. 2232530Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins)
    N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)
    automatically mapped to Pfam PF02866
  6. 2232793Protein Malate dehydrogenase [56329] (12 species)
  7. 2232841Species Haloarcula marismortui [TaxId:2238] [56335] (6 PDB entries)
  8. 2232854Domain d1hlpa2: 1hlp A:163-328 [42112]
    Other proteins in same PDB: d1hlpa1, d1hlpb1
    complexed with nad

Details for d1hlpa2

PDB Entry: 1hlp (more details), 3.2 Å

PDB Description: structural features stabilizing halophilic malate dehydrogenase from an archaebacterium
PDB Compounds: (A:) malate dehydrogenase

SCOPe Domain Sequences for d1hlpa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hlpa2 d.162.1.1 (A:163-328) Malate dehydrogenase {Haloarcula marismortui [TaxId: 2238]}
grldsarfryvlseefdapvqnvegtilgehgdaqvpvfskvrvdgtdpefsgdekeqll
gdlqesamdvierkgatewgpargvahmveailhdtgevlpasvklegefghedtafgvp
vrlgsngveeivewdlddyeqdlmadaaeklsdqydkis

SCOPe Domain Coordinates for d1hlpa2:

Click to download the PDB-style file with coordinates for d1hlpa2.
(The format of our PDB-style files is described here.)

Timeline for d1hlpa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1hlpa1