Lineage for d1d3aa2 (1d3a A:163-330)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 420654Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 420655Superfamily d.162.1: LDH C-terminal domain-like [56327] (2 families) (S)
  5. 420656Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (4 proteins)
    N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)
  6. 420744Protein Malate dehydrogenase [56329] (11 species)
  7. 420749Species Archaeon Haloarcula marismortui [TaxId:2238] [56335] (5 PDB entries)
  8. 420756Domain d1d3aa2: 1d3a A:163-330 [42110]
    Other proteins in same PDB: d1d3aa1, d1d3ab1

Details for d1d3aa2

PDB Entry: 1d3a (more details), 2.94 Å

PDB Description: crystal structure of the wild type halophilic malate dehydrogenase in the apo form

SCOP Domain Sequences for d1d3aa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d3aa2 d.162.1.1 (A:163-330) Malate dehydrogenase {Archaeon Haloarcula marismortui}
fggrldsarfryvlseefdapvqnvegtilgehgdaqvpvfskvrvdgtdpefsgdekeq
llgdlqesamdvierkgatewgpargvahmveailhdtgevlpasvklegefghedtafg
vpvrlgsngveeivewdlddyeqdlmadaaeklsdqydkis

SCOP Domain Coordinates for d1d3aa2:

Click to download the PDB-style file with coordinates for d1d3aa2.
(The format of our PDB-style files is described here.)

Timeline for d1d3aa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1d3aa1