Class h: Coiled coil proteins [57942] (7 folds) |
Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies) core: trimeric coiled coil |
Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) |
Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins) |
Protein Influenza hemagglutinin (stalk) [58066] (22 species) trimer |
Species Influenza A virus, different strains [TaxId:11320] [58067] (150 PDB entries) |
Domain d7dead_: 7dea D: [421096] Other proteins in same PDB: d7deaa_, d7deac_, d7deae_ automated match to d6vmzb_ complexed with nag |
PDB Entry: 7dea (more details), 2.84 Å
SCOPe Domain Sequences for d7dead_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7dead_ h.3.1.1 (D:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains [TaxId: 11320]} lfgaiagfieggwqgmvdgwygyhhsneqgsgyaadrestqkaidgvtnkvnsiidkmnt qfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlydk vrlqlrdnakelgngcfefyhkcdnecmesvrngtydypqyseearlkree
Timeline for d7dead_: