Lineage for d7dead_ (7dea D:)

  1. Root: SCOPe 2.08
  2. 3039230Class h: Coiled coil proteins [57942] (7 folds)
  3. 3040824Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 3040825Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 3040826Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 3040827Protein Influenza hemagglutinin (stalk) [58066] (22 species)
    trimer
  7. 3041028Species Influenza A virus, different strains [TaxId:11320] [58067] (150 PDB entries)
  8. 3084779Domain d7dead_: 7dea D: [421096]
    Other proteins in same PDB: d7deaa_, d7deac_, d7deae_
    automated match to d6vmzb_
    complexed with nag

Details for d7dead_

PDB Entry: 7dea (more details), 2.84 Å

PDB Description: structure of an avian influenza h5 hemagglutinin from the influenza virus a/duck northern china/22/2017 (h5n6)
PDB Compounds: (D:) Hemagglutinin

SCOPe Domain Sequences for d7dead_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7dead_ h.3.1.1 (D:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains [TaxId: 11320]}
lfgaiagfieggwqgmvdgwygyhhsneqgsgyaadrestqkaidgvtnkvnsiidkmnt
qfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlydk
vrlqlrdnakelgngcfefyhkcdnecmesvrngtydypqyseearlkree

SCOPe Domain Coordinates for d7dead_:

Click to download the PDB-style file with coordinates for d7dead_.
(The format of our PDB-style files is described here.)

Timeline for d7dead_:

  • d7dead_ is new in SCOPe 2.08-stable