Lineage for d7daah_ (7daa H:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 3084758Domain d7daah_: 7daa H: [421075]
    Other proteins in same PDB: d7daal2
    automated match to d4ma3h_
    complexed with cd

Details for d7daah_

PDB Entry: 7daa (more details), 2.51 Å

PDB Description: crystal structure of basigin complexed with anti-basigin fab fragment
PDB Compounds: (H:) Heavy chain of antibody Fab fragment

SCOPe Domain Sequences for d7daah_:

Sequence, based on SEQRES records: (download)

>d7daah_ b.1.1.0 (H:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
esveesggrlvtpgtpltltctvsgfslsdyamswvrqapgkglewigiiyasgstyyas
wakgrftisktsttvdlkitspttedtatyfcaryyagsdiwgpgtlvtvssastkgpsv
fplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglyslssv
vtvpssslgtqtyicnvnhkpsntkvdkkvepks

Sequence, based on observed residues (ATOM records): (download)

>d7daah_ b.1.1.0 (H:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
esveesggrlvtpgtpltltctvsgfslsdyamswvrqapgkglewigiiyasgstyyas
wakgrftisktsttvdlkitspttedtatyfcaryyagsdiwgpgtlvtvssastkgpsv
fplapsstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglyslssvvt
vpssslgtqtyicnvnhkpsntkvdkkvepks

SCOPe Domain Coordinates for d7daah_:

Click to download the PDB-style file with coordinates for d7daah_.
(The format of our PDB-style files is described here.)

Timeline for d7daah_:

  • d7daah_ is new in SCOPe 2.08-stable