SCOP 1.67: Domain d1bmdb2: 1bmd B:155-332

Lineage for d1bmdb2 (1bmd B:155-332)

1. Root: SCOP 1.67

2. Class d: Alpha and beta proteins (a+b) [53931] (260 folds)

3. Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
   unusual fold, defines family

4. Superfamily d.162.1: LDH C-terminal domain-like [56327] (2 families)

5. Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (4 proteins)
   N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)

6. Protein Malate dehydrogenase [56329] (11 species)

7. Species Thermus flavus [TaxId:274] [56334] (2 PDB entries)

8. Domain d1bmdb2: 1bmd B:155-332 [42107]
   Other proteins in same PDB: d1bmda1, d1bmdb1
   complexed with nad

Details for d1bmdb2

PDB Entry: 1bmd, 1.9 Å

PDB Description: determinants of protein thermostability observed in the 1.9 angstroms crystal structure of malate dehydrogenase from the thermophilic bacterium thermus flavus

SCOP Domain Sequences for d1bmdb2:

Sequence; same for both SEQRES and ATOM records:

>d1bmdb2 d.162.1.1 (B:155-332) Malate dehydrogenase {Thermus flavus}
trldhnrakaqlakktgtgvdrirrmtvwgnhsstmfpdlfhaevdgrpalelvdmewye
kvfiptvaqrgaaiiqargassaasaanaaiehirdwalgtpegdwvsmavpsqgeygip
egivysfpvtakdgayrvvegleinefarkrmeitaqelldemeqvkalgli

Timeline for d1bmdb2:

• d1bmdb2 first appeared (with stable ids) in SCOP 1.55
  
• d1bmdb2 appears in SCOP 1.65
  
• d1bmdb2 appears in SCOP 1.69
  
• d1bmdb2 appears in the current release, SCOPe 2.08