Lineage for d7dbke2 (7dbk E:162-334)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2998746Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 2998747Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) (S)
  5. 2998748Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins)
    N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)
    automatically mapped to Pfam PF02866
  6. 2998755Protein Lactate dehydrogenase [56339] (20 species)
  7. 2998819Species Human (Homo sapiens), heart isoform (H chain) [TaxId:9606] [64444] (4 PDB entries)
  8. 3084732Domain d7dbke2: 7dbk E:162-334 [421049]
    Other proteins in same PDB: d7dbka1, d7dbkb1, d7dbkc1, d7dbkd1, d7dbke1, d7dbkf1, d7dbkg1, d7dbkh1
    automated match to d1i0za2
    complexed with gol, nai

Details for d7dbke2

PDB Entry: 7dbk (more details), 1.8 Å

PDB Description: crystal structure of human ldhb in complex with nadh
PDB Compounds: (E:) L-lactate dehydrogenase B chain

SCOPe Domain Sequences for d7dbke2:

Sequence; same for both SEQRES and ATOM records: (download)

>d7dbke2 d.162.1.1 (E:162-334) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain) [TaxId: 9606]}
sgcnldsarfrylmaeklgihpsschgwilgehgdssvavwsgvnvagvslqelnpemgt
dndsenwkevhkmvvesayeviklkgytnwaiglsvadliesmlknlsrihpvstmvkgm
ygienevflslpcilnargltsvinqklkddevaqlkksadtlwdiqkdlkdl

SCOPe Domain Coordinates for d7dbke2:

Click to download the PDB-style file with coordinates for d7dbke2.
(The format of our PDB-style files is described here.)

Timeline for d7dbke2:

  • d7dbke2 is new in SCOPe 2.08-stable