Lineage for d2cmda2 (2cmd A:146-312)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2556795Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 2556796Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) (S)
  5. 2556797Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins)
    N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)
    automatically mapped to Pfam PF02866
  6. 2557069Protein Malate dehydrogenase [56329] (12 species)
  7. 2557104Species Escherichia coli [TaxId:562] [56333] (4 PDB entries)
  8. 2557109Domain d2cmda2: 2cmd A:146-312 [42102]
    Other proteins in same PDB: d2cmda1
    complexed with cit

Details for d2cmda2

PDB Entry: 2cmd (more details), 1.87 Å

PDB Description: the crystal structure of e.coli malate dehydrogenase: a complex of the apoenzyme and citrate at 1.87 angstroms resolution
PDB Compounds: (A:) malate dehydrogenase

SCOPe Domain Sequences for d2cmda2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cmda2 d.162.1.1 (A:146-312) Malate dehydrogenase {Escherichia coli [TaxId: 562]}
vttldiirsntfvaelkgkqpgevevpvigghsgvtilpllsqvpgvsfteqevadltkr
iqnagtevveakagggsatlsmgqaaarfglslvralqgeqgvvecayvegdgqyarffs
qplllgkngveerksigtlsafeqnalegmldtlkkdialgqefvnk

SCOPe Domain Coordinates for d2cmda2:

Click to download the PDB-style file with coordinates for d2cmda2.
(The format of our PDB-style files is described here.)

Timeline for d2cmda2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2cmda1