SCOPe 2.06: Domain d7mdhd2: 7mdh D:198-381

Lineage for d7mdhd2 (7mdh D:198-381)

Root: SCOPe 2.06
Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
unusual fold, defines family
Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families)
Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins)
N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)
automatically mapped to Pfam PF02866
Protein Malate dehydrogenase [56329] (12 species)
Species Sorghum (Sorghum vulgare), chloroplast [TaxId:4558] [56331] (1 PDB entry)
Domain d7mdhd2: 7mdh D:198-381 [42100]
Other proteins in same PDB: d7mdha1, d7mdhb1, d7mdhc1, d7mdhd1
complexed with zn

Details for d7mdhd2

PDB Entry: 7mdh (more details), 2.4 Å

PDB Description: structural basis for light acitvation of a chloroplast enzyme. the structure of sorghum nadp-malate dehydrogenase in its oxidized form

PDB Compounds: (D:) protein (malate dehydrogenase)

SCOPe Domain Sequences for d7mdhd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d7mdhd2 d.162.1.1 (D:198-381) Malate dehydrogenase {Sorghum (Sorghum vulgare), chloroplast [TaxId: 4558]}
trldenrakcqlalkagvfydkvsnvtiwgnhsttqvpdflnakidgrpvkevikrtkwl
eeeftitvqkrggaliqkwgrssaastavsiadaikslvtptpegdwfstgvyttgnpyg
iaedivfsmpcrskgdgdyelatdvsnddflwerikkseaellaekkcvahltgegnayc
dvpe

SCOPe Domain Coordinates for d7mdhd2:

Click to download the PDB-style file with coordinates for d7mdhd2.
(The format of our PDB-style files is described here.)

Timeline for d7mdhd2: