SCOPe 2.08: Domain d7bnvl1: 7bnv L:1-110

Lineage for d7bnvl1 (7bnv L:1-110)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d7bnvl1: 7bnv L:1-110 [420986]
   Other proteins in same PDB: d7bnva_
   automated match to d6o89l2
   complexed with nag

Details for d7bnvl1

PDB Entry: 7bnv, 2.35 Å

PDB Description: crystal structure of the sars-cov-2 receptor binding domain in complex with antibody ion-300

PDB Compounds: (L:) light chain

SCOPe Domain Sequences for d7bnvl1:

Sequence; same for both SEQRES and ATOM records:

>d7bnvl1 b.1.1.0 (L:1-110) automated matches {Human (Homo sapiens) [TaxId: 9606]}
divmtqspgtlslspgeratlscrasqsvsssylawyqqkpgqaprlliygastratgip
arfsgsgsgteftltisslqsedfavyycqqydnwplmhtfgqgtkleik

Timeline for d7bnvl1:

• d7bnvl1 is new in SCOPe 2.08-stable