Lineage for d4mdha2 (4mdh A:155-333)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 420654Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 420655Superfamily d.162.1: LDH C-terminal domain-like [56327] (2 families) (S)
  5. 420656Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (4 proteins)
    N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)
  6. 420744Protein Malate dehydrogenase [56329] (11 species)
  7. 420792Species Pig (Sus scrofa) [TaxId:9823] [56330] (3 PDB entries)
  8. 420797Domain d4mdha2: 4mdh A:155-333 [42095]
    Other proteins in same PDB: d4mdha1, d4mdhb1

Details for d4mdha2

PDB Entry: 4mdh (more details), 2.5 Å

PDB Description: refined crystal structure of cytoplasmic malate dehydrogenase at 2.5- angstroms resolution

SCOP Domain Sequences for d4mdha2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4mdha2 d.162.1.1 (A:155-333) Malate dehydrogenase {Pig (Sus scrofa)}
trldhnrakaqialklgvtsddvknviiwgnhsstqypdvnhakvklqakevgvyeavkd
dswlkgefittvqqrgaavikarklssamsaakaicdhvrdiwfgtpegefvsmgiisdg
nsygvpddllysfpvtikdktwkiveglpindfsrekmdltakelaeeketafeflssa

SCOP Domain Coordinates for d4mdha2:

Click to download the PDB-style file with coordinates for d4mdha2.
(The format of our PDB-style files is described here.)

Timeline for d4mdha2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4mdha1