Lineage for d5mdha2 (5mdh A:155-333)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2232528Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 2232529Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) (S)
  5. 2232530Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins)
    N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)
    automatically mapped to Pfam PF02866
  6. 2232793Protein Malate dehydrogenase [56329] (12 species)
  7. 2232856Species Pig (Sus scrofa) [TaxId:9823] [56330] (3 PDB entries)
  8. 2232861Domain d5mdha2: 5mdh A:155-333 [42093]
    Other proteins in same PDB: d5mdha1, d5mdhb1
    complexed with mak, nad

Details for d5mdha2

PDB Entry: 5mdh (more details), 2.4 Å

PDB Description: crystal structure of ternary complex of porcine cytoplasmic malate dehydrogenase alpha-ketomalonate and tnad at 2.4 angstroms resolution
PDB Compounds: (A:) malate dehydrogenase

SCOPe Domain Sequences for d5mdha2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5mdha2 d.162.1.1 (A:155-333) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]}
trldhnrakaqialklgvtsddvknviiwgnhsstqypdvnhakvklqakevgvyeavkd
dswlkgefittvqqrgaavikarklssamsaakaicdhvrdiwfgtpegefvsmgiisdg
nsygvpddllysfpvtikdktwkiveglpindfsrekmdltakelaeeketafeflssa

SCOPe Domain Coordinates for d5mdha2:

Click to download the PDB-style file with coordinates for d5mdha2.
(The format of our PDB-style files is described here.)

Timeline for d5mdha2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5mdha1