Lineage for d1mldd2 (1mld D:145-313)
- Root: SCOP 1.57
Class d: Alpha and beta proteins (a+b) [53931] (194 folds) 
Fold d.162: Lactate & malate dehydrogenases, C-terminal domain [56326] (1 superfamily) Superfamily d.162.1: Lactate & malate dehydrogenases, C-terminal domain [56327] (1 family) 
Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (4 proteins) 
Protein Malate dehydrogenase [56329] (7 species) 
Species Pig (Sus scrofa) [TaxId:9823] [56330] (3 PDB entries) 
Domain d1mldd2: 1mld D:145-313 [42092]
Other proteins in same PDB: d1mlda1, d1mldb1, d1mldc1, d1mldd1
Details for d1mldd2
PDB Entry: 1mld (more details), 1.9 Å
PDB Description: refined structure of mitochondrial malate dehydrogenase from porcine heart and the consensus structure for dicarboxylic acid oxidoreductases
SCOP Domain Sequences for d1mldd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mldd2 d.162.1.1 (D:145-313) Malate dehydrogenase {Pig (Sus scrofa)}
vttldivranafvaelkgldparvsvpvigghagktiiplisqctpkvdfpqdqlstltg
riqeagtevvkakagagsatlsmayagarfvfslvdamngkegvvecsfvksqetdcpyf
stplllgkkgieknlgigkispfeekmiaeaipelkasikkgeefvknm
SCOP Domain Coordinates for d1mldd2:
Click to download the PDB-style file with coordinates for d1mldd2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1mldd2:
View in 3D
