Lineage for d7cnne_ (7cnn E:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2733644Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
    not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 2733915Superfamily a.137.10: Stathmin [101494] (1 family) (S)
    single long helix crosslinking four tubulin subunits
    automatically mapped to Pfam PF00836
  5. 2733916Family a.137.10.1: Stathmin [101495] (2 proteins)
  6. 2733917Protein Stathmin 4 [101496] (3 species)
  7. 2733927Species Mouse (Mus musculus) [TaxId:10090] [390534] (14 PDB entries)
  8. 3084579Domain d7cnne_: 7cnn E: [420896]
    Other proteins in same PDB: d7cnnf1, d7cnnf2, d7cnnf3
    automated match to d6qtne_
    complexed with ca, cl, gdf, gdp, gtp, mes, mg

Details for d7cnne_

PDB Entry: 7cnn (more details), 2.5 Å

PDB Description: vinorelbine in complex with tubulin
PDB Compounds: (E:) Stathmin-4

SCOPe Domain Sequences for d7cnne_:

Sequence, based on SEQRES records: (download)

>d7cnne_ a.137.10.1 (E:) Stathmin 4 {Mouse (Mus musculus) [TaxId: 10090]}
mevielnkctsgqsfevilkppsfdgvpefnaslprrrdpsleeiqkkleaaeerrkyqe
aellkhlaekrehereviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqe
kdkhaeevrknkelkee

Sequence, based on observed residues (ATOM records): (download)

>d7cnne_ a.137.10.1 (E:) Stathmin 4 {Mouse (Mus musculus) [TaxId: 10090]}
mevielnkctsgqsfevilkppsdpsleeiqkkleaaeerrkyqeaellkhlaekreher
eviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqekdkhaeevrknkelk
ee

SCOPe Domain Coordinates for d7cnne_:

Click to download the PDB-style file with coordinates for d7cnne_.
(The format of our PDB-style files is described here.)

Timeline for d7cnne_:

  • d7cnne_ is new in SCOPe 2.08-stable