SCOPe 2.08: Domain d7cmja_: 7cmj A:

Lineage for d7cmja_ (7cmj A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.61: PRTase-like [53270] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest

4. Superfamily c.61.1: PRTase-like [53271] (3 families)

5. Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (16 proteins)

6. Protein automated matches [190074] (15 species)
   not a true protein

7. Species Leishmania donovani [TaxId:981087] [420827] (1 PDB entry)

8. Domain d7cmja_: 7cmj A: [420893]
   automated match to d1pzma_
   complexed with ba, cl, mg, peg, pg4, po4

Details for d7cmja_

PDB Entry: 7cmj, 2.76 Å

PDB Description: crystal structure of l.donovani hypoxanthine-guanine phosphoribosyl transferase (hgprt)

PDB Compounds: (A:) hypoxanthine phosphoribosyltransferase

SCOPe Domain Sequences for d7cmja_:

Sequence; same for both SEQRES and ATOM records:

>d7cmja_ c.61.1.1 (A:) automated matches {Leishmania donovani [TaxId: 981087]}
ypmsahtlvtqeqvwaatakcakkiaedyrsfklttdnplyllcvlkgsfiftadlarfl
adegvpvkveficassygtgvetsgqvrmlldvrdsvenrhilivedivdsaitlqylmr
fmlakkpaslktvvlldkpsgrkvevlvdypvitiphafvigygmdyaesyrelrdicvl
kkey

Timeline for d7cmja_:

• d7cmja_ is new in SCOPe 2.08-stable