SCOPe 2.08: Domain d7b82a1: 7b82 A:1796-1898

Lineage for d7b82a1 (7b82 A:1796-1898)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.2: Bromodomain [47370] (2 families)

5. Family a.29.2.0: automated matches [191428] (1 protein)
   not a true family

6. Protein automated matches [190615] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187641] (1052 PDB entries)

8. Domain d7b82a1: 7b82 A:1796-1898 [420882]
   Other proteins in same PDB: d7b82a2
   automated match to d6fgga_
   complexed with t3h

Details for d7b82a1

PDB Entry: 7b82, 1.25 Å

PDB Description: baz2a bromodomain in complex with triazole compound ms04-tn03

PDB Compounds: (A:) Bromodomain adjacent to zinc finger domain protein 2A

SCOPe Domain Sequences for d7b82a1:

Sequence; same for both SEQRES and ATOM records:

>d7b82a1 a.29.2.0 (A:1796-1898) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hsdltfceiilmemeshdaawpflepvnprlvsgyrriiknpmdfstmrhrlsrggytss
eefaadallvfdncqtfneddsevgkaghimrrffesrweefy

Timeline for d7b82a1:

• d7b82a1 is new in SCOPe 2.08-stable