Lineage for d7cnvd_ (7cnv D:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3007687Fold d.224: SufE/NifU [82648] (1 superfamily)
    alpha(2)-beta(3)-alpha(3); 2 layers alpha/beta, 3-stranded antiparallel beta-sheet; order 123
  4. 3007688Superfamily d.224.1: SufE/NifU [82649] (4 families) (S)
    iron-sulfur cluster assembly proteins
  5. 3007772Family d.224.1.0: automated matches [191547] (1 protein)
    not a true family
  6. 3007773Protein automated matches [190942] (7 species)
    not a true protein
  7. 3007797Species Methanothrix thermoacetophila [TaxId:2224] [404561] (3 PDB entries)
  8. 3084553Domain d7cnvd_: 7cnv D: [420870]
    Other proteins in same PDB: d7cnva2, d7cnve2
    automated match to d7c8na_
    complexed with 1pe, fe2, fes, pge, so4

Details for d7cnvd_

PDB Entry: 7cnv (more details), 2.23 Å

PDB Description: crystal structure of iscu h106c variant
PDB Compounds: (D:) Nitrogen-fixing NifU domain protein

SCOPe Domain Sequences for d7cnvd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7cnvd_ d.224.1.0 (D:) automated matches {Methanothrix thermoacetophila [TaxId: 2224]}
miqqtgyskkvmehfmnprnvgviddpdgygkvgnpvcgdlmeifikvgdekiedikfrt
fgcgaaiatssmitemargksleeamritrndvadaldglppqkmccsnlaadalhaain
dylskkq

SCOPe Domain Coordinates for d7cnvd_:

Click to download the PDB-style file with coordinates for d7cnvd_.
(The format of our PDB-style files is described here.)

Timeline for d7cnvd_:

  • d7cnvd_ is new in SCOPe 2.08-stable