Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.224: SufE/NifU [82648] (1 superfamily) alpha(2)-beta(3)-alpha(3); 2 layers alpha/beta, 3-stranded antiparallel beta-sheet; order 123 |
Superfamily d.224.1: SufE/NifU [82649] (4 families) iron-sulfur cluster assembly proteins |
Family d.224.1.0: automated matches [191547] (1 protein) not a true family |
Protein automated matches [190942] (7 species) not a true protein |
Species Methanothrix thermoacetophila [TaxId:2224] [404561] (3 PDB entries) |
Domain d7cnvd_: 7cnv D: [420870] Other proteins in same PDB: d7cnva2, d7cnve2 automated match to d7c8na_ complexed with 1pe, fe2, fes, pge, so4 |
PDB Entry: 7cnv (more details), 2.23 Å
SCOPe Domain Sequences for d7cnvd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7cnvd_ d.224.1.0 (D:) automated matches {Methanothrix thermoacetophila [TaxId: 2224]} miqqtgyskkvmehfmnprnvgviddpdgygkvgnpvcgdlmeifikvgdekiedikfrt fgcgaaiatssmitemargksleeamritrndvadaldglppqkmccsnlaadalhaain dylskkq
Timeline for d7cnvd_: