Lineage for d2ushb2 (2ush B:26-362)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 36927Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily)
  4. 36928Superfamily d.159.1: Metallo-dependent phosphatases [56300] (3 families) (S)
  5. 36950Family d.159.1.2: 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain [56307] (1 protein)
  6. 36951Protein 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain [56308] (1 species)
  7. 36952Species Escherichia coli [TaxId:562] [56309] (2 PDB entries)
  8. 36955Domain d2ushb2: 2ush B:26-362 [42081]
    Other proteins in same PDB: d2usha1, d2ushb1

Details for d2ushb2

PDB Entry: 2ush (more details), 2.22 Å

PDB Description: 5'-nucleotidase from e. coli

SCOP Domain Sequences for d2ushb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ushb2 d.159.1.2 (B:26-362) 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain {Escherichia coli}
yeqdktykitvlhtndhhghfwrneygeyglaaqktlvdgirkevaaeggsvlllsggdi
ntgvpesdlqdaepdfrgmnlvgydamaignhefdnpltvlrqqekwakfpllsaniyqk
stgerlfkpwalfkrqdlkiaviglttddtakignpeyftdiefrkpadeaklviqelqq
tekpdiiiaathmghydngehgsnapgdvemaralpagslamivgghsqdpvcmaaenkk
qvdyvpgtpckpdqqngiwivqahewgkyvgradfefrngemkmvnyqlipvnlkkkvtw
edgkservlytpeiaenqqmisllspfqnkgkaqlev

SCOP Domain Coordinates for d2ushb2:

Click to download the PDB-style file with coordinates for d2ushb2.
(The format of our PDB-style files is described here.)

Timeline for d2ushb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2ushb1