Lineage for d7bgi8_ (7bgi 8:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3028373Fold f.43: Chlorophyll a-b binding protein [103510] (1 superfamily)
    membrane all-alpha fold; three transmembrane helices
  4. 3028374Superfamily f.43.1: Chlorophyll a-b binding protein [103511] (2 families) (S)
    duplication: contains two structural repeats
  5. 3028425Family f.43.1.0: automated matches [276197] (1 protein)
    not a true family
  6. 3028426Protein automated matches [276200] (4 species)
    not a true protein
  7. 3028445Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [370435] (9 PDB entries)
  8. 3084487Domain d7bgi8_: 7bgi 8: [420804]
    Other proteins in same PDB: d7bgia_, d7bgib_, d7bgic_, d7bgid_, d7bgie_, d7bgif_, d7bgij_, d7bgil_
    automated match to d7dz78_
    complexed with 3ph, bcr, c7z, ca, chl, cl0, cla, dao, dga, dgd, lhg, lmg, lmt, lpx, lut, nkp, oca, plm, pqn, qtb, rrx, sf4, sph, sqd, t7x; mutant

Details for d7bgi8_

PDB Entry: 7bgi (more details), 2.54 Å

PDB Description: photosystem i of a temperature sensitive mutant chlamydomonas reinhardtii
PDB Compounds: (8:) Chlorophyll a-b binding protein, chloroplastic

SCOPe Domain Sequences for d7bgi8_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7bgi8_ f.43.1.0 (8:) automated matches {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]}
rqswlpgsqipahldtpaaqalagnfgfdplglgkdpvalrwyqqaelihcrtamagvag
ilipglltkagalnvpewydagkvaiensfapwgsllavqlflcgfveakrwqdirkpgs
qgepgsflgfeaslkgtselgypggpfdplglskeadkwadwklkevkngrlamlaflgf
vaqkyatgagpvdnlaahlkdpwhvnyatngvslpfl

SCOPe Domain Coordinates for d7bgi8_:

Click to download the PDB-style file with coordinates for d7bgi8_.
(The format of our PDB-style files is described here.)

Timeline for d7bgi8_:

  • d7bgi8_ is new in SCOPe 2.08-stable