Lineage for d7bjyb1 (7bjy B:29-136)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2706693Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 2706694Superfamily a.29.2: Bromodomain [47370] (2 families) (S)
  5. 2706927Family a.29.2.0: automated matches [191428] (1 protein)
    not a true family
  6. 2706928Protein automated matches [190615] (15 species)
    not a true protein
  7. 2706959Species Human (Homo sapiens) [TaxId:9606] [187641] (1052 PDB entries)
  8. 3084483Domain d7bjyb1: 7bjy B:29-136 [420800]
    Other proteins in same PDB: d7bjyb2
    automated match to d7layb_
    complexed with 79c, edo

Details for d7bjyb1

PDB Entry: 7bjy (more details), 2.22 Å

PDB Description: crystal structure of the first bromodomain (bd1) of human brdt bound to ro3280
PDB Compounds: (B:) Isoform 2 of Bromodomain testis-specific protein

SCOPe Domain Sequences for d7bjyb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d7bjyb1 a.29.2.0 (B:29-136) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tnqlqylqkvvlkdlwkhsfswpfqrpvdavklqlpdyytiiknpmdlntikkrlenkyy
akaseciedfntmfsncylynkpgddivlmaqaleklfmqklsqmpqe

SCOPe Domain Coordinates for d7bjyb1:

Click to download the PDB-style file with coordinates for d7bjyb1.
(The format of our PDB-style files is described here.)

Timeline for d7bjyb1:

  • d7bjyb1 is new in SCOPe 2.08-stable

View in 3D
Domains from same chain:
(mouse over for more information)
d7bjyb2
View in 3D
Domains from other chains:
(mouse over for more information)
d7bjya_