Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.43: Chlorophyll a-b binding protein [103510] (1 superfamily) membrane all-alpha fold; three transmembrane helices |
Superfamily f.43.1: Chlorophyll a-b binding protein [103511] (2 families) duplication: contains two structural repeats |
Family f.43.1.0: automated matches [276197] (1 protein) not a true family |
Protein automated matches [276200] (4 species) not a true protein |
Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [370435] (9 PDB entries) |
Domain d7blx4_: 7blx 4: [420781] Other proteins in same PDB: d7blxa_, d7blxb_, d7blxc_, d7blxd_, d7blxe_, d7blxf_, d7blxj_, d7blxl_ automated match to d7dz74_ complexed with 3ph, bcr, c7z, ca, chl, cl0, cla, dao, dga, dgd, lhg, lmg, lmt, lpx, lut, nkp, oca, plm, pqn, qtb, rrx, sf4, sph, sqd; mutant |
PDB Entry: 7blx (more details), 3.15 Å
SCOPe Domain Sequences for d7blx4_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7blx4_ f.43.1.0 (4:) automated matches {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]} daalpswmpgadlpgylngtlpgdfgfdplylgqdpvklkwyaqaelmnarfamlavagi lvpellsnigfswpgagvawydagkfeyfapasslfgvqmllfawveirryqdfvkpgsa nqdpiftnnklpdgnepgypggifdpfgwskgdikslklkeikngrlamlafagfigqay ttgttplknlsthladpwsttvwqndlarl
Timeline for d7blx4_: