SCOPe 2.08: Domain d7beud2: 7beu D:85-217

Lineage for d7beud2 (7beu D:85-217)

Root: SCOPe 2.08
Class a: All alpha proteins [46456] (290 folds)
Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
this domains follows the thioredoxin-like N-terminal domain
Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)
Protein Class mu GST [81348] (3 species)
Species Human (Homo sapiens) [TaxId:9606] [47622] (17 PDB entries)
Uniprot P09488 P28161
Domain d7beud2: 7beu D:85-217 [420778]
Other proteins in same PDB: d7beua1, d7beub1, d7beuc1, d7beud1
automated match to d1xw6a1
complexed with na

Details for d7beud2

PDB Entry: 7beu (more details), 1.59 Å

PDB Description: human glutathione transferase m1-1

PDB Compounds: (D:) Glutathione S-transferase Mu 1

SCOPe Domain Sequences for d7beud2:

Sequence; same for both SEQRES and ATOM records: (download)

>d7beud2 a.45.1.1 (D:85-217) Class mu GST {Human (Homo sapiens) [TaxId: 9606]}
lcgeteeekirvdilenqtmdnhmqlgmicynpefeklkpkyleelpeklklyseflgkr
pwfagnkitfvdflvydvldlhrifepkcldafpnlkdfisrfeglekisaymkssrflp
rpvfskmavwgnk

SCOPe Domain Coordinates for d7beud2:

Click to download the PDB-style file with coordinates for d7beud2.
(The format of our PDB-style files is described here.)

Timeline for d7beud2: