SCOPe 2.08: Domain d7beud1: 7beu D:0-84

Lineage for d7beud1 (7beu D:0-84)

Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
Superfamily c.47.1: Thioredoxin-like [52833] (24 families)
Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins)
Protein Class mu GST [81359] (3 species)
Species Human (Homo sapiens) [TaxId:9606] [52867] (17 PDB entries)
Uniprot P09488 ! Uniprot P28161
Domain d7beud1: 7beu D:0-84 [420777]
Other proteins in same PDB: d7beua2, d7beub2, d7beuc2, d7beud2
automated match to d1xw6a2
complexed with na

Details for d7beud1

PDB Entry: 7beu (more details), 1.59 Å

PDB Description: human glutathione transferase m1-1

PDB Compounds: (D:) Glutathione S-transferase Mu 1

SCOPe Domain Sequences for d7beud1:

Sequence; same for both SEQRES and ATOM records: (download)

>d7beud1 c.47.1.5 (D:0-84) Class mu GST {Human (Homo sapiens) [TaxId: 9606]}
mpmilgywdirglahairllleytdssyeekkytmgdapdydrsqwlnekfklgldfpnl
pylidgahkitqsnailcyiarkhn

SCOPe Domain Coordinates for d7beud1:

Click to download the PDB-style file with coordinates for d7beud1.
(The format of our PDB-style files is described here.)

Timeline for d7beud1: