SCOPe 2.08: Domain d7b1xb_: 7b1x B:

Lineage for d7b1xb_ (7b1x B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.0: automated matches [191404] (1 protein)
   not a true family

6. Protein automated matches [190543] (131 species)
   not a true protein

7. Species Uncultured bacterium [TaxId:77133] [196706] (50 PDB entries)

8. Domain d7b1xb_: 7b1x B: [420749]
   automated match to d3g9ta_

Details for d7b1xb_

PDB Entry: 7b1x, 2.3 Å

PDB Description: crystal structure of cold-active esterase pmgl3 from permafrost metagenomic library

PDB Compounds: (B:) esterase PMGL3

SCOPe Domain Sequences for d7b1xb_:

Sequence; same for both SEQRES and ATOM records:

>d7b1xb_ c.69.1.0 (B:) automated matches {Uncultured bacterium [TaxId: 77133]}
mngndpdiagfkqqlvqmtamresqppsieierqmfdaqhgavppaegcliepistggvr
geritpksadtskaliyfhggghlfgsalshrhlvsrlaaaagvvaynmeyrlapenpyp
aglddaeqayrfvlaqgfkpediivagesaggnlaaalllklrdqdlpqpagayllspwl
dmsqsgasyeargphdpmithnaltgcsaayragasaedplispakadladlpslfiqvg
adevllsdsveftrraalagldvrlhvwanmvhawplfhfalpvsglaaideagawisrq
lg

Timeline for d7b1xb_:

• d7b1xb_ is new in SCOPe 2.08-stable