Lineage for d7aqlc1 (7aql C:9-241)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 3084149Species Mus musculus [TaxId:10090] [420466] (16 PDB entries)
  8. 3084429Domain d7aqlc1: 7aql C:9-241 [420746]
    Other proteins in same PDB: d7aqla2, d7aqlb2, d7aqlc2, d7aqld2
    automated match to d4lash_
    complexed with so4

Details for d7aqlc1

PDB Entry: 7aql (more details), 1.8 Å

PDB Description: crystal structure of an anti-plasminogen activator inhibitor-1 (pai-1) scfv antibody fragment (scfv-33h1f7)
PDB Compounds: (C:) scFv-33H1F7

SCOPe Domain Sequences for d7aqlc1:

Sequence, based on SEQRES records: (download)

>d7aqlc1 b.1.1.0 (C:9-241) automated matches {Mus musculus [TaxId: 10090]}
aevvkpgasvklactasgfnikdtyihwvkqgpeqglewigridpangntkydskfqdka
titadtssntaylhlssltsedtavyycvrgdydyvyfdywgqgttvtvssggggsgggg
sggggsdiqmtqspsslsaslgdrvtiscrasqdisnfldwyqqkpdgtvklliyytsrl
hsgvpsrfsgsgsgtdysltiskleqediatyfcqqgntfpptfgggtkleik

Sequence, based on observed residues (ATOM records): (download)

>d7aqlc1 b.1.1.0 (C:9-241) automated matches {Mus musculus [TaxId: 10090]}
aevvkpgasvklactasgfnikdtyihwvkqgpeqglewigridpangntkydskfqdka
titadtssntaylhlssltsedtavyycvrgdydyvyfdywgqgttvtvssdiqmtqsps
slsaslgdrvtiscrasqdisnfldwyqqkpdgtvklliyytsrlhsgvpsrfsgsgsgt
dysltiskleqediatyfcqqgntfpptfgggtkleik

SCOPe Domain Coordinates for d7aqlc1:

Click to download the PDB-style file with coordinates for d7aqlc1.
(The format of our PDB-style files is described here.)

Timeline for d7aqlc1:

  • d7aqlc1 is new in SCOPe 2.08-stable