Lineage for d7b4bb_ (7b4b B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2767182Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 2767925Superfamily b.2.5: p53-like transcription factors [49417] (8 families) (S)
  5. 2767926Family b.2.5.2: p53 DNA-binding domain-like [81314] (3 proteins)
  6. 2767927Protein p53 tumor suppressor, DNA-binding domain [49419] (2 species)
  7. 2767928Species Human (Homo sapiens) [TaxId:9606] [49420] (71 PDB entries)
  8. 3084322Domain d7b4bb_: 7b4b B: [420639]
    automated match to d4ibva_
    protein/DNA complex; complexed with edo, peg, qn8, qnn, zn; mutant

Details for d7b4bb_

PDB Entry: 7b4b (more details), 1.76 Å

PDB Description: structural basis of reactivation of oncogenic p53 mutants by a small molecule: methylene quinuclidinone (mq). human p53dbd-r273c mutant bound to mq: r273c-mq (i)
PDB Compounds: (B:) Cellular tumor antigen p53

SCOPe Domain Sequences for d7b4bb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7b4bb_ b.2.5.2 (B:) p53 tumor suppressor, DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]}
vpsqktyqgsygfrlgflhsgtaksvtctyspalnkmfcqlaktcpvqlwvdstpppgtr
vramaiykqsqhmtevvrrcphhercsdsdglappqhlirvegnlrveylddrntfrhsv
vvpyeppevgsdcttihynymcnsscmggmnrrpiltiitledssgnllgrnsfevcvca
cpgrdrrteee

SCOPe Domain Coordinates for d7b4bb_:

Click to download the PDB-style file with coordinates for d7b4bb_.
(The format of our PDB-style files is described here.)

Timeline for d7b4bb_:

  • d7b4bb_ is new in SCOPe 2.08-stable