Lineage for d7apjb1 (7apj B:3-115)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2743671Species Llama (Lama glama) [TaxId:9844] [187485] (245 PDB entries)
  8. 3084262Domain d7apjb1: 7apj B:3-115 [420579]
    Other proteins in same PDB: d7apjb2
    automated match to d6b20e_

Details for d7apjb1

PDB Entry: 7apj (more details), 2.05 Å

PDB Description: structure of autoinhibited akt1 reveals mechanism of pip3-mediated activation
PDB Compounds: (B:) nb41

SCOPe Domain Sequences for d7apjb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d7apjb1 b.1.1.1 (B:3-115) automated matches {Llama (Lama glama) [TaxId: 9844]}
qlvesggglvqaggslrlscaasgidvriktmawyrqapgkqrellasvlvsgstnyadp
vkgrftisrdnakntvylqmnklipddtavyycntygrlrrdvwgpgtqvtvs

SCOPe Domain Coordinates for d7apjb1:

Click to download the PDB-style file with coordinates for d7apjb1.
(The format of our PDB-style files is described here.)

Timeline for d7apjb1:

  • d7apjb1 is new in SCOPe 2.08-stable

3084262
d7apjb1 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d7apjb2