SCOPe 2.08: Domain d7ahrb1: 7ahr B:2-282

Lineage for d7ahrb1 (7ahr B:2-282)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)
   has additional insertions and/or extensions that are not grouped together
   

6. Protein automated matches [190140] (37 species)
   not a true protein

7. Species Streptomyces coelicolor [TaxId:100226] [420521] (1 PDB entry)

8. Domain d7ahrb1: 7ahr B:2-282 [420562]
   Other proteins in same PDB: d7ahra2, d7ahra3, d7ahrb2, d7ahrb3
   automated match to d2nxoa1
   complexed with gol, rdh

Details for d7ahrb1

PDB Entry: 7ahr, 2.21 Å

PDB Description: enzyme of biosynthetic pathway

PDB Compounds: (B:) Chorismate dehydratase

SCOPe Domain Sequences for d7ahrb1:

Sequence; same for both SEQRES and ATOM records:

>d7ahrb1 c.94.1.1 (B:2-282) automated matches {Streptomyces coelicolor [TaxId: 100226]}
dnsrtrprvghiqflnclplywglartgtlldfeltkdtpeklseqlvrgdldigpvtlv
eflknaddlvafpdiavgcdgpvmscvivsqvpldrldgarvalgstsrtsvrlaqllls
erfgvqpdyytcppdlslmmqeadaavligdaalranmidgprygldvhdlgalwkewtg
lpfvfavwaarrdyaerepvitrkvheaflasrnlsleevekvaeqaarweafdedtlak
yfttldfrfgapqleavtefarrvgpttgfpadvkvellkp

Timeline for d7ahrb1:

• d7ahrb1 is new in SCOPe 2.08-stable