Lineage for d7b0wc1 (7b0w C:1-121)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2764596Superfamily b.1.11: PapD-like [49354] (3 families) (S)
    contains PP switch between strands D and C'
  5. 2764597Family b.1.11.1: Pilus chaperone [49355] (6 proteins)
    automatically mapped to Pfam PF00345
  6. 2764615Protein Periplasmic chaperone FimC [49358] (1 species)
  7. 2764616Species Escherichia coli [TaxId:562] [49359] (11 PDB entries)
  8. 3084242Domain d7b0wc1: 7b0w C:1-121 [420559]
    Other proteins in same PDB: d7b0wc2, d7b0wc3, d7b0wi_
    automated match to d1ze3c1
    complexed with edo, fmt

Details for d7b0wc1

PDB Entry: 7b0w (more details), 1.75 Å

PDB Description: crystal structure of the e. coli type 1 pilus assembly inhibitor fimi bound to fimc
PDB Compounds: (C:) chaperone protein fimc

SCOPe Domain Sequences for d7b0wc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d7b0wc1 b.1.11.1 (C:1-121) Periplasmic chaperone FimC {Escherichia coli [TaxId: 562]}
gvalgatrviypagqkqeqlavtnndenstyliqswvenadgvkdgrfivtpplfamkgk
kentlrildatnnqlpqdreslfwmnvkaipsmdkskltentlqlaiisriklyyrpakl
a

SCOPe Domain Coordinates for d7b0wc1:

Click to download the PDB-style file with coordinates for d7b0wc1.
(The format of our PDB-style files is described here.)

Timeline for d7b0wc1:

  • d7b0wc1 is new in SCOPe 2.08-stable

View in 3D
Domains from other chains:
(mouse over for more information)
d7b0wi_