Class b: All beta proteins [48724] (180 folds) |
Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
Superfamily b.2.3: Bacterial adhesins [49401] (7 families) |
Family b.2.3.0: automated matches [191391] (1 protein) not a true family |
Protein automated matches [190503] (10 species) not a true protein |
Species Escherichia coli [TaxId:83333] [346217] (8 PDB entries) |
Domain d7b0wi_: 7b0w I: [420558] Other proteins in same PDB: d7b0wc1, d7b0wc2, d7b0wc3 automated match to d6swhf_ complexed with edo, fmt |
PDB Entry: 7b0w (more details), 1.75 Å
SCOPe Domain Sequences for d7b0wi_:
Sequence, based on SEQRES records: (download)
>d7b0wi_ b.2.3.0 (I:) automated matches {Escherichia coli [TaxId: 83333]} aetcrieagdkqmtvnmgqissnrfhavgedsapvpfvihlrecstvvservgvafhgva dgknpdvlsvgegpgiatnigvalfddegnlvpinrppanwkrlysgstslhfiakyrat grrvtggianaqawfsltyq
>d7b0wi_ b.2.3.0 (I:) automated matches {Escherichia coli [TaxId: 83333]} aetcrieagdkqmtvnmgqissnrfhavgedsapvpfvihlrecstvvservgvafhgva dgknpdvlsvgegpgiatnigvalfddegnlvpinrppanwkstslhfiakyratgrrvt ggianaqawfsltyq
Timeline for d7b0wi_: