SCOPe 2.08: Domain d7azqe1: 7azq E:2-91

Lineage for d7azqe1 (7azq E:2-91)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
   2 helices; antiparallel hairpin, left-handed twist

4. Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families)
   automatically mapped to Pfam PF00081

5. Family a.2.11.0: automated matches [227154] (1 protein)
   not a true family

6. Protein automated matches [226859] (39 species)
   not a true protein

7. Species Rhodobacter capsulatus [TaxId:1061] [420547] (2 PDB entries)

8. Domain d7azqe1: 7azq E:2-91 [420548]
   Other proteins in same PDB: d7azqa2, d7azqe2
   automated match to d4yipa1
   complexed with ca, fe

Details for d7azqe1

PDB Entry: 7azq, 2 Å

PDB Description: crystal structure of the iron/manganese cambialistic superoxide dismutase from rhodobacter capsulatus complex with fe

PDB Compounds: (E:) superoxide dismutase [fe]

SCOPe Domain Sequences for d7azqe1:

Sequence; same for both SEQRES and ATOM records:

>d7azqe1 a.2.11.0 (E:2-91) automated matches {Rhodobacter capsulatus [TaxId: 1061]}
afelpalpyahdalaslgmsketleyhhdlhhkayvdngnkliagtewegksveeivkgt
ycagavaqsgifnnasqhwnhaqfwemmgp

Timeline for d7azqe1:

• d7azqe1 is new in SCOPe 2.08-stable