Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.318: SARS receptor-binding domain-like [143586] (1 superfamily) core: 3 layers, a/b/a; antiparallel beta-sheet of 5 strands, order 13542 |
Superfamily d.318.1: SARS receptor-binding domain-like [143587] (1 family) automatically mapped to Pfam PF09408 |
Family d.318.1.1: SARS receptor-binding domain-like [143588] (2 proteins) part of PfamB PB000266 |
Protein automated matches [420532] (2 species) not a true protein |
Species Severe acute respiratory syndrome coronavirus 2 [TaxId:2697049] [420533] (4 PDB entries) |
Domain d7b0bf_: 7b0b F: [420534] Other proteins in same PDB: d7b0bh_, d7b0bl_ automated match to d7m3ic_ |
PDB Entry: 7b0b (more details), 2.98 Å
SCOPe Domain Sequences for d7b0bf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7b0bf_ d.318.1.1 (F:) automated matches {Severe acute respiratory syndrome coronavirus 2 [TaxId: 2697049]} tnlcpfgevfnatrfasvyawnrkrisncvadysvlynsasfstfkcygvsptklndlcf tnvyadsfvirgdevrqiapgqtgkiadynyklpddftgcviawnsnnldskvggnynyl yrlfrksnlkpferdisteiyqagstpcngvegfncyfplqsygfqptngvgyqpyrvvv lsfellhapatvcgp
Timeline for d7b0bf_: