SCOPe 2.08: Domain d7ayva1: 7ayv A:1-215

Lineage for d7ayva1 (7ayv A:1-215)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.28: Cryptochrome/photolyase, N-terminal domain [52424] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32145; Rossmann-like

4. Superfamily c.28.1: Cryptochrome/photolyase, N-terminal domain [52425] (2 families)
   automatically mapped to Pfam PF00875

5. Family c.28.1.0: automated matches [227292] (1 protein)
   not a true family

6. Protein automated matches [227113] (4 species)
   not a true protein

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [231380] (8 PDB entries)

8. Domain d7ayva1: 7ayv A:1-215 [420498]
   Other proteins in same PDB: d7ayva2
   automated match to d2wq7a1
   complexed with fad, gol, so4

Details for d7ayva1

PDB Entry: 7ayv, 1.79 Å

PDB Description: x-ray crystallographic structure of (6-4)photolyase from drosophila melanogaster at cryogenic temperature

PDB Compounds: (A:) RE11660p

SCOPe Domain Sequences for d7ayva1:

Sequence; same for both SEQRES and ATOM records:

>d7ayva1 c.28.1.0 (A:1-215) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
mdsqrstlvhwfrkglrlhdnpalshiftaanaapgryfvrpifildpgildwmqvganr
wrflqqtledldnqlrklnsrlfvvrgkpaevfprifkswrvemltfetdiepysvtrda
avqklakaegvrvethcshtiynpelviaknlgkapityqkflgiveqlkvpkvlgvpek
lknmptppkdeveqkdsaaydcptmkqlvkrpeel

Timeline for d7ayva1:

• d7ayva1 is new in SCOPe 2.08-stable