Lineage for d7au3d_ (7au3 D:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3024792Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 3025589Superfamily f.23.8: Bacterial aa3 type cytochrome c oxidase subunit IV [81469] (1 family) (S)
    automatically mapped to Pfam PF07835
  5. 3025590Family f.23.8.1: Bacterial aa3 type cytochrome c oxidase subunit IV [81468] (2 proteins)
  6. 3084155Protein automated matches [420472] (1 species)
    not a true protein
  7. 3084156Species Paracoccus denitrificans [TaxId:266] [420473] (4 PDB entries)
  8. 3084157Domain d7au3d_: 7au3 D: [420474]
    Other proteins in same PDB: d7au3a_, d7au3c_
    automated match to d1qled_
    complexed with 2fk, ca, cu, cua, hea, mn, o, pgv

Details for d7au3d_

PDB Entry: 7au3 (more details), 2.56 Å

PDB Description: cytochrome c oxidase structure in f-state
PDB Compounds: (D:) Cytochrome c oxidase subunit 4

SCOPe Domain Sequences for d7au3d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7au3d_ f.23.8.1 (D:) automated matches {Paracoccus denitrificans [TaxId: 266]}
hkhgemdirhqqatfagfikgatwvsilsiavlvflalans

SCOPe Domain Coordinates for d7au3d_:

Click to download the PDB-style file with coordinates for d7au3d_.
(The format of our PDB-style files is described here.)

Timeline for d7au3d_:

  • d7au3d_ is new in SCOPe 2.08-stable