Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
Superfamily f.23.8: Bacterial aa3 type cytochrome c oxidase subunit IV [81469] (1 family) automatically mapped to Pfam PF07835 |
Family f.23.8.1: Bacterial aa3 type cytochrome c oxidase subunit IV [81468] (2 proteins) |
Protein automated matches [420472] (1 species) not a true protein |
Species Paracoccus denitrificans [TaxId:266] [420473] (4 PDB entries) |
Domain d7au3d_: 7au3 D: [420474] Other proteins in same PDB: d7au3a_, d7au3c_ automated match to d1qled_ complexed with 2fk, ca, cu, cua, hea, mn, o, pgv |
PDB Entry: 7au3 (more details), 2.56 Å
SCOPe Domain Sequences for d7au3d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7au3d_ f.23.8.1 (D:) automated matches {Paracoccus denitrificans [TaxId: 266]} hkhgemdirhqqatfagfikgatwvsilsiavlvflalans
Timeline for d7au3d_: