Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (31 species) not a true protein |
Species Mus musculus [TaxId:10090] [420466] (16 PDB entries) |
Domain d7aqld1: 7aql D:9-242 [420467] Other proteins in same PDB: d7aqla2, d7aqlb2, d7aqlc2, d7aqld2 automated match to d4lash_ complexed with so4 |
PDB Entry: 7aql (more details), 1.8 Å
SCOPe Domain Sequences for d7aqld1:
Sequence, based on SEQRES records: (download)
>d7aqld1 b.1.1.0 (D:9-242) automated matches {Mus musculus [TaxId: 10090]} aevvkpgasvklactasgfnikdtyihwvkqgpeqglewigridpangntkydskfqdka titadtssntaylhlssltsedtavyycvrgdydyvyfdywgqgttvtvssggggsgggg sggggsdiqmtqspsslsaslgdrvtiscrasqdisnfldwyqqkpdgtvklliyytsrl hsgvpsrfsgsgsgtdysltiskleqediatyfcqqgntfpptfgggtkleikr
>d7aqld1 b.1.1.0 (D:9-242) automated matches {Mus musculus [TaxId: 10090]} aevvkpgasvklactasgfnikdtyihwvkqgpeqglewigridpangntkydskfqdka titadtssntaylhlssltsedtavyycvrgdydyvyfdywgqgttvtvssdiqmtqsps slsaslgdrvtiscrasqdisnfldwyqqkpdgtvklliyytsrlhsgvpsrfsgsgsgt dysltiskleqediatyfcqqgntfpptfgggtkleikr
Timeline for d7aqld1: