Lineage for d7ardd_ (7ard D:)

  1. Root: SCOPe 2.08
  2. 3012399Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. 3018743Fold e.18: HydB/Nqo4-like [56761] (1 superfamily)
    3 domains: (1) all-alpha; (2&3) alpha+beta
  4. 3018744Superfamily e.18.1: HydB/Nqo4-like [56762] (3 families) (S)
  5. 3018909Family e.18.1.0: automated matches [191637] (1 protein)
    not a true family
  6. 3018910Protein automated matches [191173] (18 species)
    not a true protein
  7. 3084129Species Polytomella sp. [TaxId:37502] [420446] (2 PDB entries)
  8. 3084132Domain d7ardd_: 7ard D: [420449]
    automated match to d6khjh_
    complexed with 8q1, cdl, fes, fmn, ndp, pc7, pty, sf4, zn

Details for d7ardd_

PDB Entry: 7ard (more details), 3.11 Å

PDB Description: cryo-em structure of polytomella complex-i (complete composition)
PDB Compounds: (D:) nd7

SCOPe Domain Sequences for d7ardd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7ardd_ e.18.1.0 (D:) automated matches {Polytomella sp. [TaxId: 37502]}
mkpltpskvsnftinfgpqhpaahgvlrlvlemdgeiikradphigllhrgteklleykt
ynqgipyfdrldyvsmmcmehsyvlaieqllnvavplrgqyirvlfseitrimnhilait
chsmdvgaltpflwafeereklfefyervsgarmhaayfrvggvaqdlpigllrdiydws
rqfasrvdemeelltgnriwkertidvglvtaqqawdwgcsgpilrgsgidwdlrknqpy
dvygrmdfnvpiaghgdcydrylvrvqemreslriiyqclnempdglyktpdqkvsppsr
gqmkqsmeslihhfklfsegyhvpagetyraveapkgefgvylvsrggnrpyrckirspg
yahlqmldmvakgamladvvtiigtldvvfgeidr

SCOPe Domain Coordinates for d7ardd_:

Click to download the PDB-style file with coordinates for d7ardd_.
(The format of our PDB-style files is described here.)

Timeline for d7ardd_:

  • d7ardd_ is new in SCOPe 2.08-stable