Lineage for d2bmia_ (2bmi A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2996664Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 2996665Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (16 families) (S)
  5. 2996666Family d.157.1.1: Zn metallo-beta-lactamase [56282] (2 proteins)
  6. 2996667Protein Zn metallo-beta-lactamase [56283] (14 species)
  7. 2996722Species Bacteroides fragilis [TaxId:817] [56285] (10 PDB entries)
  8. 2996727Domain d2bmia_: 2bmi A: [42043]
    complexed with na, zn

Details for d2bmia_

PDB Entry: 2bmi (more details), 2 Å

PDB Description: metallo-beta-lactamase
PDB Compounds: (A:) protein (class b beta-lactamase)

SCOPe Domain Sequences for d2bmia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bmia_ d.157.1.1 (A:) Zn metallo-beta-lactamase {Bacteroides fragilis [TaxId: 817]}
svkisddisitqlsdkvytyvslaeiegwgmvpsngmivinnhqaalldtpindaqteml
vnwvtdslhakvttfipnhwhgdcigglgylqrkgvqsyanqmtidlakekglpvpehgf
tdsltvsldgmplqcyylggghatdnivvwlptenilfggcmlkdnqatsignisdadvt
awpktldkvkakfpsaryvvpghgdyggteliehtkqivnqyiestsk

SCOPe Domain Coordinates for d2bmia_:

Click to download the PDB-style file with coordinates for d2bmia_.
(The format of our PDB-style files is described here.)

Timeline for d2bmia_: