Lineage for d7a3sb2 (7a3s B:296-393)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2765063Superfamily b.1.18: E set domains [81296] (27 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2766140Family b.1.18.0: automated matches [191341] (1 protein)
    not a true family
  6. 2766141Protein automated matches [190226] (81 species)
    not a true protein
  7. 3084059Species Dengue virus 3 philippines/h87/1956 [TaxId:408870] [420376] (1 PDB entry)
  8. 3084093Domain d7a3sb2: 7a3s B:296-393 [420410]
    Other proteins in same PDB: d7a3sa1, d7a3sb1, d7a3sb3, d7a3sc1, d7a3sc3
    automated match to d1tg8a1
    complexed with nag, so4

Details for d7a3sb2

PDB Entry: 7a3s (more details), 2.8 Å

PDB Description: crystal structure of dengue 3 virus envelope glycoprotein
PDB Compounds: (B:) Genome polyprotein

SCOPe Domain Sequences for d7a3sb2:

Sequence, based on SEQRES records: (download)

>d7a3sb2 b.1.18.0 (B:296-393) automated matches {Dengue virus 3 philippines/h87/1956 [TaxId: 408870]}
syamclntfvlkkevsetqhgtilikveykgedapckipfstedgqgkahngrlitanpv
vtkkeepvnieaeppfgesnivigigdkalkinwyrkg

Sequence, based on observed residues (ATOM records): (download)

>d7a3sb2 b.1.18.0 (B:296-393) automated matches {Dengue virus 3 philippines/h87/1956 [TaxId: 408870]}
syamclntfvlkkevsetqhgtilikveykgedapckipfstegrlitanpvvtkkeepv
nieaeppfgesnivigigdkalkinwyrkg

SCOPe Domain Coordinates for d7a3sb2:

Click to download the PDB-style file with coordinates for d7a3sb2.
(The format of our PDB-style files is described here.)

Timeline for d7a3sb2:

  • d7a3sb2 is new in SCOPe 2.08-stable