Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (27 families) "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
Family b.1.18.0: automated matches [191341] (1 protein) not a true family |
Protein automated matches [190226] (81 species) not a true protein |
Species Dengue virus 3 philippines/h87/1956 [TaxId:408870] [420376] (1 PDB entry) |
Domain d7a3sb2: 7a3s B:296-393 [420410] Other proteins in same PDB: d7a3sa1, d7a3sb1, d7a3sb3, d7a3sc1, d7a3sc3 automated match to d1tg8a1 complexed with nag, so4 |
PDB Entry: 7a3s (more details), 2.8 Å
SCOPe Domain Sequences for d7a3sb2:
Sequence, based on SEQRES records: (download)
>d7a3sb2 b.1.18.0 (B:296-393) automated matches {Dengue virus 3 philippines/h87/1956 [TaxId: 408870]} syamclntfvlkkevsetqhgtilikveykgedapckipfstedgqgkahngrlitanpv vtkkeepvnieaeppfgesnivigigdkalkinwyrkg
>d7a3sb2 b.1.18.0 (B:296-393) automated matches {Dengue virus 3 philippines/h87/1956 [TaxId: 408870]} syamclntfvlkkevsetqhgtilikveykgedapckipfstegrlitanpvvtkkeepv nieaeppfgesnivigigdkalkinwyrkg
Timeline for d7a3sb2: