Class a: All alpha proteins [46456] (290 folds) |
Fold a.29: Bromodomain-like [47363] (15 superfamilies) 4 helices; bundle; minor mirror variant of up-and-down topology |
Superfamily a.29.2: Bromodomain [47370] (2 families) |
Family a.29.2.0: automated matches [191428] (1 protein) not a true family |
Protein automated matches [190615] (15 species) not a true protein |
Species Schistosoma mansoni [TaxId:6183] [420379] (2 PDB entries) |
Domain d7amcb_: 7amc B: [420380] automated match to d2dwwa_ complexed with 73b, edo, gol |
PDB Entry: 7amc (more details), 1.22 Å
SCOPe Domain Sequences for d7amcb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7amcb_ a.29.2.0 (B:) automated matches {Schistosoma mansoni [TaxId: 6183]} lrlsealkacsnilkdissqryrdlnhfflkpvdvvalglhdyydvvkkamdlstiktkl esgqyhtkydfaddvrlmfnncykyngedsevarvgkqlqaifdenfakvpddes
Timeline for d7amcb_: