Lineage for d7amcb_ (7amc B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2706693Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 2706694Superfamily a.29.2: Bromodomain [47370] (2 families) (S)
  5. 2706927Family a.29.2.0: automated matches [191428] (1 protein)
    not a true family
  6. 2706928Protein automated matches [190615] (15 species)
    not a true protein
  7. 3084062Species Schistosoma mansoni [TaxId:6183] [420379] (2 PDB entries)
  8. 3084063Domain d7amcb_: 7amc B: [420380]
    automated match to d2dwwa_
    complexed with 73b, edo, gol

Details for d7amcb_

PDB Entry: 7amc (more details), 1.22 Å

PDB Description: smbrd3(2), bromodomain 2 of the bromodomain 3 protein from schistosoma mansoni in complex with ibet726
PDB Compounds: (B:) Putative bromodomain-containing protein 3, brd3

SCOPe Domain Sequences for d7amcb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7amcb_ a.29.2.0 (B:) automated matches {Schistosoma mansoni [TaxId: 6183]}
lrlsealkacsnilkdissqryrdlnhfflkpvdvvalglhdyydvvkkamdlstiktkl
esgqyhtkydfaddvrlmfnncykyngedsevarvgkqlqaifdenfakvpddes

SCOPe Domain Coordinates for d7amcb_:

Click to download the PDB-style file with coordinates for d7amcb_.
(The format of our PDB-style files is described here.)

Timeline for d7amcb_:

  • d7amcb_ is new in SCOPe 2.08-stable