Lineage for d1dxka_ (1dxk A:)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily) Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (3 families) 
Family d.157.1.1: Zn metallo-beta-lactamase [56282] (1 protein) Protein Zn metallo-beta-lactamase [56283] (4 species) 
Species Bacillus cereus [TaxId:1396] [56284] (6 PDB entries) 
Domain d1dxka_: 1dxk A: [42036]
Details for d1dxka_
PDB Entry: 1dxk (more details), 1.85 Å
PDB Description: metallo-beta-lactamase from bacillus cereus 569/h/9 c168s mutant
SCOP Domain Sequences for d1dxka_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dxka_ d.157.1.1 (A:) Zn metallo-beta-lactamase {Bacillus cereus}
tviknetgtisisqlnknvwvhtelgsfngeavpsnglvlntskglvlvdsswddkltke
liemvekkfqkrvtdviithahadriggiktlkergikahstaltaelakkngyeeplgd
lqtvtnlkfgnmkvetfypgkghtednivvwlpqynilvggslvkstsakdlgnvadayv
newstsienvlkryrninavvpghgevgdkglllhtldllk
SCOP Domain Coordinates for d1dxka_:
Click to download the PDB-style file with coordinates for d1dxka_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1dxka_:
- d1dxka_ appears in SCOP 1.57
- d1dxka_ appears in the current release, SCOPe 2.08
View in 3D